Search results for "C [POLY I]"

showing 10 items of 30703 documents

Comparative Theoretical Analysis of BN Nanotubes Doped with Al, P, Ga, As, In, and Sb

2013

SUMMARY AND CONCLUDING REMARKS We have performed large-scale first-principles calculations ofthe electronic structure of (5,5) boron nitride nanotubescontaining the following substitutional impurity atoms: Al, P,Ga, As, In, and Sb. Calculations have been performed using thetwo methods: (i) linear combination of atomic orbitals(LCAO) with the atomic-centered Gaussian-type functions asa basis set and (ii) linearized augmented cylindrical wave(LACW) accompanied with the local density functional andmuffin-tin approximations for the electronic potential. In arelatively good qualitative agreement, both methods predict lowformation energies and, thus, relative stability of point defectsthat are assoc…

010302 applied physicsChemistryBand gap02 engineering and technologyElectronic structure021001 nanoscience & nanotechnology01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsBond lengthchemistry.chemical_compoundGeneral EnergyBoron nitrideLinear combination of atomic orbitals0103 physical sciencesDensity of statesPhysical and Theoretical ChemistryAtomic physics0210 nano-technologyElectronic band structureBasis setThe Journal of Physical Chemistry C
researchProduct

Conic optical fiber probe for generation and characterization of microbubbles in liquids

2021

Abstract A novel optical fiber probe has been developed to provide mechanical stability to microbubbles generated in fluids, the tip of the fiber is etched with hydrofluoric acid to pierce a truncated horn that fastens the microbubbles to the fiber tip and prevents misalignment or detachment caused by convection currents, vibrations or shocks in the liquid. Microbubbles are photo-thermally generated on the etched fiber and used as Fabry-Perot cavity sensor. Two methods were used to interrogate the probe: the first one, in the wavelength domain, is suitable for calibration in static or quasi static situations; the second one, in the time domain, can be used in dynamic environments. Experimen…

010302 applied physicsConvectionMaterials sciencebusiness.industryMetals and Alloys02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsWavelengthOptics0103 physical sciencesMicrobubblesCalibrationFiberTime domainElectrical and Electronic Engineering0210 nano-technologybusinessInstrumentationQuasistatic processBar (unit)Sensors and Actuators A: Physical
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

From EFTA to EC/EU and Back to EFTA? The European Economic Area (EEA) As a Possible Scenario for the UK-EU Relations After Brexit

2018

Brexit is announced to take place and it appears, that the most probable scenario for the UK is the “Norway-Option”, i.e., to (again) become a member of the European Free Trade Association (EFTA) and join the EEA. The chapter identifies the major claims of the leave-campaign to analyse, whether by doing so, the Brexit proponents will achieve what they campaigned for. Furthermore, the paper explains the functioning of the EEA, exploring the potential changes for the UK, the EU, and the EEA/EFTA.

010302 applied physicsEconomic integrationbusiness.industry02 engineering and technologyInternational trade021001 nanoscience & nanotechnology01 natural sciencesDomestic marketBrexitPolitical science0103 physical sciences0210 nano-technologybusinessFree trade
researchProduct

RBS and ERD cross-sections and optical model parameters for the analysis of lithium, boron and nickel

2000

Abstract Elastic scattering cross-sections for RBS analysis of nickel by 7 Li and 11 B ion backscattering near the Coulomb barrier have been determined. The lithium ion measurements were performed in the energy range of 8–15 MeV at the laboratory angles of 115° and 135°. For boron ions the energies between 14 and 24 MeV and scattering angles of 89°, 110° and 130° were used. For the analysis of lithium and boron by ERD the scattering cross-sections have been calculated by kinematically reversing the backscattering process. The calculated 58 Ni ion energies thus varied between 65 and 125 MeV for lithium and between 75 and 130 MeV for boron recoils. For the Li + Ni and B + Ni systems the thres…

010302 applied physicsElastic scatteringNuclear and High Energy PhysicsScatteringchemistry.chemical_elementCoulomb barrier02 engineering and technology021001 nanoscience & nanotechnology7. Clean energy01 natural sciencesIonNickelsymbols.namesakechemistry0103 physical sciencessymbolsLithiumRutherford scatteringAtomic physics0210 nano-technologyBoronInstrumentationNuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms
researchProduct

Modelling of expected B, C, N and O Lyman-α line intensities emitted from W7-X plasmas and measured by means of the W7-X light impurity monitor system

2021

AbstractThe “C/O Monitor” for Wendelstein 7-X (W7-X) is a dedicated light impurity XUV spectrometer intended to measure Lyman-α transitions of hydrogen-like ions of four low-Z impurities—boron (4.9 nm), carbon (3.4 nm), nitrogen (2.5 nm) and oxygen (1.9 nm). Since the discussed diagnostic will deliver continuous information about the line intensities, it is crucial to understand the origin of the obtained signals with respect to the experimental plasma conditions (electron temperature and density). This, however, might be difficult because of the broad acceptance angle of the spectrometer and irregular shape of the plasma edge or SOL where the radiation is expected to mostly come from, depe…

010302 applied physicsElectron densityMaterials scienceSpectrometerGeneral Physics and AstronomyPlasma01 natural sciences010305 fluids & plasmasIonRadiant fluxImpurityExtreme ultraviolet0103 physical sciencesElectron temperatureAtomic physics
researchProduct

Photo-electrical and transport properties of hydrothermal ZnO

2016

We performed the studies of optical, photoelectric, and transport properties of a hydrothermal bulk n-type ZnO crystal by using the contactless optical techniques: photoluminescence, light-induced transient grating, and differential reflectivity. Optical studies revealed bound exciton and defect-related transitions between the donor states (at ∼60 meV and ∼240 meV below the conduction band) and the deep acceptor states (at 0.52 eV above the valence band). The acceptor state was ascribed to VZn, and its thermal activation energy of 0.43 eV was determined. A low value of carrier diffusion coefficient (∼0.1 cm2/s) at low excitations and temperatures up to 800 K was attributed to impact the rec…

010302 applied physicsElectron mobilityPhotoluminescenceChemistryBand gapExcitonWide-bandgap semiconductorGeneral Physics and Astronomy02 engineering and technologyCarrier lifetime021001 nanoscience & nanotechnology01 natural sciencesAcceptorMolecular physicsCrystalCondensed Matter::Materials Science0103 physical sciencesAtomic physics0210 nano-technologyJournal of Applied Physics
researchProduct

Formation of dislocations and hardening of LiF under high-dose irradiation with 5–21 MeV 12C ions

2017

R. Zabels, I. Manika, J. Maniks, and R.Grants acknowledge the national project IMIS2, and A. Dauletbekova, M. Baizhumanov, and M. Zdorovets the Ministry of Education and Science of the Republic of Kazakhstan for the financial support.

010302 applied physicsEnergy lossMaterials sciencePhysics::Instrumentation and DetectorsAtomic force microscopyAstrophysics::High Energy Astrophysical PhenomenaPhysics::Medical Physicsmacromolecular substances02 engineering and technologyGeneral ChemistryNanoindentation021001 nanoscience & nanotechnology01 natural sciencesMolecular physicsIsotropic etchingElastic collisionIonPhysics::Plasma Physics0103 physical sciences:NATURAL SCIENCES:Physics [Research Subject Categories]Hardening (metallurgy)General Materials ScienceIrradiationAtomic physics0210 nano-technologyApplied Physics A
researchProduct

A Magnetohydrodynamic Auxiliary Propulsion system for docking assistance of autonomous vehicle

2016

In this article we present an approach to the description of Magnetohydrodynamic Auxiliary Propulsion system for docking assistance of autonomous vehicle. Preliminarily, an analytical model which includes an electromagnetic model and a thermal model is presented. Successively, in order to move beyond the analytical model, a 3-D MHD modeling tool and a Runge Kutta method based solver are presented and they are used to investigate an alternative MHD solutions. Some numerical analysis are given

010302 applied physicsEngineeringbusiness.industryNumerical analysis05 social sciencesControl engineeringOcean EngineeringSolverPropulsionSettore ING-IND/32 - Convertitori Macchine E Azionamenti ElettriciOceanography01 natural sciencesRunge–Kutta methodsMagnetohydrodinamic Propulsion SystemSettore ING-INF/04 - AutomaticaPhysics::Space Physics0502 economics and business0103 physical sciencesMagnetohydrodynamic driveElectromagnetic modelMagnetohydrodynamicsThermal modelbusinessInstrumentation050203 business & management
researchProduct

Polarization and acoustic properties of barium-modified lead-free potassium–sodium niobate ceramics

2017

The publication costs of this article were covered by the Estonian Academy of Sciences and the University of Tartu.

010302 applied physicsFerroelectricsCeramicsMaterials science010308 nuclear & particles physicsGeneral EngineeringAnalytical chemistryElastic propertieschemistry.chemical_elementRelaxorsBarium01 natural scienceschemistryPotassium sodiumDielectric permittivityvisual_artPolarization0103 physical sciencesvisual_art.visual_art_medium:NATURAL SCIENCES:Physics [Research Subject Categories]CeramicPolarization (electrochemistry)Solid solutionsProceedings of the Estonian Academy of Sciences
researchProduct